PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 352aa    MW: 39924.2 Da    PI: 7.2828
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490073.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.7e-311569155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt++LH+rF+ea +qLGG+ekAtPk++++lm+++gLtl+h+kSHLQkYRl
  XP_004490073.1 15 KPRLKWTHDLHQRFIEATNQLGGAEKATPKSLMRLMGIPGLTLYHLKSHLQKYRL 69
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-291371IPR009057Homeodomain-like
SuperFamilySSF466892.51E-151470IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-211570IPR006447Myb domain, plants
PfamPF002498.5E-71768IPR001005SANT/Myb domain
PfamPF143792.1E-21111157IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MKNQSKHFVL SSNAKPRLKW THDLHQRFIE ATNQLGGAEK ATPKSLMRLM GIPGLTLYHL  60
KSHLQKYRLG KSQQLEKYSD NKQEDYTETK SFDGHCSREI SLGENQINEN MHIADALEMQ  120
MEVEKKLYEQ IEVQKHLQLR IEAQGKYLQS VLSKAHEALS TYNSSSIGIK LKKSELSQLV  180
IMINNACPNS PISEVIENGK LSLNSEERKM DRGTICSLES SLISCESSKR KEEKHSIEGL  240
TNSSTISLEL PLMTMQSEEK SVSCLVSESV SVSDNLSNET NERKRNAATE SDGNYIEQCS  300
YKKRCGNKMK KEKLSKMFDL NRQCENEMDS TSSKILLDLN CSLIYGNHED GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490073.10.0PREDICTED: uncharacterized protein LOC101501127 isoform X1
TrEMBLG7KGL21e-158G7KGL2_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA01G05920.21e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.18e-70G2-like family protein